SEA-PHAGES Logo

The official website of the HHMI Science Education Alliance-Phage Hunters Advancing Genomics and Evolutionary Science program.

Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.

All posts created by debbie

| posted 22 Aug, 2018 15:52
While further investigation may yield a more specific designation, the gene products that match Lambda repressor C1 are called "helix-turn-helix DNA binding proteins". Example: Auxilium gp49(reverse) & gp50 (forward).
Edited 22 Aug, 2018 15:54
Posted in: Cluster AY Annotation TipsRepressor-like proteins
| posted 15 Aug, 2018 23:46
I just looked at the genome of KandZ (Cluster D1). There is a VIP2 gene in that area in other phage genomes (Troll4_gp7). For reasons I have not yet investigated, gene 6 and 7 (in most of these genomes) are in the same pham (4561). But only the second gene hits VIP2 in HHPred. In addition, that second gene can be in a different pham (5921)that is not a VIP2. This true in KandZ. (posted 8-15-1smile
Posted in: Cluster D Annotation TipsVIP2 is not in all Cluster D genomes
| posted 06 Aug, 2018 16:27
Sally,
Hi. Using web Phamerator's gene numbers, I would call gene 16 a TAC. Neither 15 or 18 are good candidates by HHpred (gp 15 is a ribosomal protein hit) and 18 has no significant matches). I believe that gp 16 is also a TAC, BUT I would not call it. I can't find a slippery sequence and the Pfam hit is too weak for me.
Posted in: Cluster Q Annotation Tipstail assembly chaperones
| posted 25 Jul, 2018 16:37
I am not sure exactly how to answer this without seeing data. Know that we made a decision about 1 1/2 years ago, to call every small gene between the major capsid and the major tail a -head-to-tail connector protein. Those calls should be ignored without HHPred info.

If your BLAST hits our phages, you should be able to tell the difference because when we were calling 'everything', the label was "head-to-tail connector". Once we made the change we are labeling true hits to head-to-tail proteins "head-to-tail connector complex proteins".

I hope that helps. it is a bit confusing.
debbie
Posted in: Functional AnnotationHead-tail connectors
| posted 24 Jul, 2018 03:49
The last feature of this genome is not in phamerator or in the gene list on phagesDB:
CDS join(16287..16604,1..96)
/gene="25"
/locus_tag="PBI_EMPEROR_25"
/codon_start=1
/transl_table=11
/product="HNH endonuclease"
/translation="MTALPAWAGDYSRRLTALCLATYGDTCHLCGRPGATTADHLIPR
SVSYDDSLANLRPAHQRCNSARGAMPIETWRARFTASTAPRSSRWSRPSSSLTPQVSA
ALRPAAFFSPNAQNKGSVHTEKPSETTKGPDNATT"
Posted in: Cluster DM Annotation Tipsa wrap around gene at the end
| posted 22 Jul, 2018 02:35
Maria,
I would call both of these. They meet the cut-off criteria that we have set forth.
for Neferthena, it looks like the end are called correctly.
For Andromedas, you will need to trim the last 2 bases (GA).
debbie
Edited 22 Jul, 2018 10:54
Posted in: tRNAstRNA in EA2 and EA5 phages called by tRNAscan SE but not aragorn
| posted 26 Jun, 2018 21:14
Germán,
Excellent obse4rvaton of the data!
-debbie
Posted in: Frameshifts and IntronsNew frameshift in an A1 phage?
| posted 22 Jun, 2018 17:17
Hi. I sent an email to Dex and Claire about this.
Technically, we are not reporting codon or anti-codon but rather the DNA sequence that makes the anti-codon. So I can see why this gets confusing.
Edited 22 Jun, 2018 19:42
Posted in: PECAANPECAAN and tRNA notes problem?
| posted 21 Jun, 2018 21:56
Evan,
GeneMark does call all starts ATG, GTG, and TTG (you will find that GenMark can agree with Glimmer on a TTG start in DNA Master). However, GeneMrk's graphic output is only coded to represent ATG (longer upticks) and TTG (shorter upticks) starts. I think they ran out of money to update all of the graphic displays…..
Posted in: Choosing Start SitesDoes GeneMark identify all potential start sites?
| posted 21 Jun, 2018 16:24
Check out the genes upstream of the tail assembly chaperone (in Adaia, they are genes 8 and 9). it is easy to see that gene 8 is the major tail (HHPred results). Remember that it matches the SPP1 crystal structure project. This gene matches "H" which is a major tail protein and NOT the portal or head-to-tail connector complex protein. I am wondering if there is a legitimate programmed frameshift with this protein. See Baranov, et al 2006 where a major tail +1 ribosomal slippage is cited in a Listeria phage, PSA. While our slippery sequence doesn't match the one found in that major tail protein, our major tail protein - gp 8 - is 140 amino acids, while gp9 is 130 amino acids. A quick look at other major tail proteins across the actinobacteriophages, I have found gp sizes of 170 - 282 amino acids. Just wondering if the major tail protein is in 2 genes in this case. Further review is needed.
Edited 21 Jun, 2018 16:27
Posted in: Cluster AX Annotation TipsMajor Tail Proteins