Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
All posts created by scaruso
Link to this post | posted 09 Aug, 2019 21:47 | |
---|---|
|
Hello all, I think I have the 'terminase, small subunit' in IchabodCrane, a BE2, in which it hasn't yet been identified. It looks very similar to gp3 from NEHalo in terms of coverage and the coiled-coils hits using PCOILS. Could you take a look and see if you agree? I think it is a reasonable call. IchabodCrane_gp121 MKECPICGKDKELDEFGRQITNPSKFYKWCRDCRLSMARRKKNNFDEGRALRSKTVQLRRLTDAQVTEVRLLAEWNTPYTEIAQQYGVSATTISKVVNRGYANVY HHPred https://toolkit.tuebingen.mpg.de/#/jobs/Ichabod_g121 PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/ICH121 For reference, NEHalo gp3 in HHPred and PCOILS: HHPred https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3b PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3 Thanks! Steve I created a fresh post of this labeled BE - terminase, small subunit, here: https://seaphages.org/forums/topic/4942/?page=1#post-7410 |
Posted in: Functional Annotation → Cluster A1 terminase, small subunit
Link to this post | posted 03 Aug, 2019 21:15 | |
---|---|
|
Welkin, Should we use D family protein or protein D family? I think that's all we need, then can submit. Thanks! Steve |
Posted in: Request a new function on the SEA-PHAGES official list → TerD, tellurium resistance protein
Link to this post | posted 16 Jul, 2019 12:51 | |
---|---|
|
We found a homolog in a Bacillus phage we just annotated, I believe, and called it: DNA mimic domain containing protein, since the coding sequence was larger than the domain you describe above, but contained it. But if it is the right size, perhaps DNA mimic protein might be a good choice? Steve |
Posted in: Request a new function on the SEA-PHAGES official list → new antirestriction protein type
Link to this post | posted 15 Jul, 2019 17:07 | |
---|---|
|
Excellent, thanks! Steve |
Posted in: Request a new function on the SEA-PHAGES official list → TerD, tellurium resistance protein
Link to this post | posted 14 Jul, 2019 21:22 | |
---|---|
|
Hello, We would like to propose the addition of TerD or tellurium resistance protein, or the equivalent, to the approved function list. We believe pham 15777, which currently includes: Shows compelling evidence for the functional call. Examination of the protein sequence here: >Geostin gp71 MINLTKGSAPVTLSKAARMSVRITWPAATDYDAGAEILYKDGTTESIATFGARGVDAKLTSLTGKVRHNGDATRGAGTATETIDIDHDDEIVEIRPWAYSAQSNGTGSFRKYAVSMEVSNGTDTVKIDANNASNHDNVYTCVPAVLRFTGDGVQVEYAELYSDPRSEARPAFKKSGLLGKLKFTMDGPRNNYK By HHPred: https://toolkit.tuebingen.mpg.de/#/jobs/SEAGEOSTIN71 And by BlastP: https://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Get&RID=JPXJD11B01R Shows high coverage and high confidence matches to the tellurium resistance protein TerD in multiple bacterial species. A brief literature search found that the gene has been found in phages infecting : Salmonella and Cronobacter spp.: https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-14-481 and https://atrium.lib.uoguelph.ca/xmlui/handle/10214/7414, Pseudomona spp https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4178739/, Clostridium spp. https://www.ncbi.nlm.nih.gov/pubmed/17322187, and Bacillus spp.: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4178739/ The domain, as shown in Phamerator is also found by the CDD: https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi?RID=JPXJCJHM01R Thanks, Steve |
Posted in: Request a new function on the SEA-PHAGES official list → TerD, tellurium resistance protein
Link to this post | posted 01 Jul, 2019 21:02 | |
---|---|
|
OK, here's a dumb question. But I figure, someone needs to ask them. I have seen the "Number of Genes" field in Phagesdb where it is a total including tRNA genes and where it doesn't include tRNAs gene and, presumably reflects only protein coding genes. I would assume it is supposed to be the CDS number since at the input it says '# of ORFs' not genes, but the output says 'genes.' Can you clarify, so I know for sure? Thanks, Steve |
Posted in: General Message Board → Phagesdb Entry Question
Link to this post | posted 28 Jun, 2019 15:58 | |
---|---|
|
Excellent, Question, though. I caught up on the meeting that I had to leave from yesterday and have a question that pertains to this. Perhaps the new version of the virtual machine could include some of these useful tools all put together? The new Starterator from Chris, a standalone Aragorn in case we loose it in the future (or it's down again, or until we can host it somewhere), the new version of the splitstree prep-program, and the newest version of the checker? I'd happily upgrade. Steve |
Posted in: tRNAs → Aragorn Issue
Link to this post | posted 25 Jun, 2019 15:41 | |
---|---|
|
It won't load for me at all, still. I asked some people to try it at the last SMART meeting, and it didn't load for them either, so there may be something going on. Welkin mentioned she heard there may be a retirement coming up. Steve |
Posted in: tRNAs → Aragorn Issue
Link to this post | posted 19 Jun, 2019 13:32 | |
---|---|
|
Has anyone been having trouble accessing Aragorn? We have not been able to access it for a couple days now. Steve |
Posted in: tRNAs → Aragorn Issue
Link to this post | posted 24 May, 2019 21:16 | |
---|---|
|
These are big phages. S. |