Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
All posts created by scaruso
Link to this post | posted 01 Oct, 2019 15:34 | |
---|---|
|
Hello, I hesitate to ask this question because I don't want to imply impatience. But I want to know what to tell students who are asking me questions. So, here goes. How often are phages entries checked in to PhagesDB? I am hoping to give students some sort of estimate, if possible, and prevent some of the double entries I know you get. Thanks! Steve |
Posted in: General Message Board → Phages DB Entries
Link to this post | posted 18 Aug, 2019 20:03 | |
---|---|
|
I see you added Topcons now, too. Cool! Steve |
Posted in: PECAAN → New Features in PECAAN
Link to this post | posted 12 Aug, 2019 18:34 | |
---|---|
|
Welkin, The thing that worries us about both this and Nehal 03 was that it looked a lot like we were seeing just the DNA binding part of a gene, like with the many anti-toxin hits we get that are really just HTH-domains. But it was similar enough to the previous call to merit a look. Thanks! Steve |
Link to this post | posted 12 Aug, 2019 00:47 | |
---|---|
|
Hello all, I think I might have the 'terminase, small subunit' in the BE2 IchabodCrane, which hasn't yet been identified. It looks very similar to gp3 from NEHalo in terms of coverage and the coiled-coils hits using PCOILS described in the forum post: https://seaphages.org/forums/topic/4736/. IchabodCrane_gp121 MKECPICGKDKELDEFGRQITNPSKFYKWCRDCRLSMARRKKNNFDEGRALRSKTVQLRRLTDAQVTEVRLLAEWNTPYTEIAQQYGVSATTISKVVNRGYANVY HHPred https://toolkit.tuebingen.mpg.de/#/jobs/Ichabod_g121 PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/ICH121 For reference, NEHalo gp3 in HHPred and PCOILS: HHPred https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3b PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3 Let me know what you think. Thanks! Steve |
Link to this post | posted 09 Aug, 2019 21:47 | |
---|---|
|
Hello all, I think I have the 'terminase, small subunit' in IchabodCrane, a BE2, in which it hasn't yet been identified. It looks very similar to gp3 from NEHalo in terms of coverage and the coiled-coils hits using PCOILS. Could you take a look and see if you agree? I think it is a reasonable call. IchabodCrane_gp121 MKECPICGKDKELDEFGRQITNPSKFYKWCRDCRLSMARRKKNNFDEGRALRSKTVQLRRLTDAQVTEVRLLAEWNTPYTEIAQQYGVSATTISKVVNRGYANVY HHPred https://toolkit.tuebingen.mpg.de/#/jobs/Ichabod_g121 PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/ICH121 For reference, NEHalo gp3 in HHPred and PCOILS: HHPred https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3b PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3 Thanks! Steve I created a fresh post of this labeled BE - terminase, small subunit, here: https://seaphages.org/forums/topic/4942/?page=1#post-7410 |
Posted in: Functional Annotation → Cluster A1 terminase, small subunit
Link to this post | posted 03 Aug, 2019 21:15 | |
---|---|
|
Welkin, Should we use D family protein or protein D family? I think that's all we need, then can submit. Thanks! Steve |
Posted in: Request a new function on the SEA-PHAGES official list → TerD, tellurium resistance protein
Link to this post | posted 16 Jul, 2019 12:51 | |
---|---|
|
We found a homolog in a Bacillus phage we just annotated, I believe, and called it: DNA mimic domain containing protein, since the coding sequence was larger than the domain you describe above, but contained it. But if it is the right size, perhaps DNA mimic protein might be a good choice? Steve |
Posted in: Request a new function on the SEA-PHAGES official list → new antirestriction protein type
Link to this post | posted 15 Jul, 2019 17:07 | |
---|---|
|
Excellent, thanks! Steve |
Posted in: Request a new function on the SEA-PHAGES official list → TerD, tellurium resistance protein
Link to this post | posted 14 Jul, 2019 21:22 | |
---|---|
|
Hello, We would like to propose the addition of TerD or tellurium resistance protein, or the equivalent, to the approved function list. We believe pham 15777, which currently includes: Shows compelling evidence for the functional call. Examination of the protein sequence here: >Geostin gp71 MINLTKGSAPVTLSKAARMSVRITWPAATDYDAGAEILYKDGTTESIATFGARGVDAKLTSLTGKVRHNGDATRGAGTATETIDIDHDDEIVEIRPWAYSAQSNGTGSFRKYAVSMEVSNGTDTVKIDANNASNHDNVYTCVPAVLRFTGDGVQVEYAELYSDPRSEARPAFKKSGLLGKLKFTMDGPRNNYK By HHPred: https://toolkit.tuebingen.mpg.de/#/jobs/SEAGEOSTIN71 And by BlastP: https://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Get&RID=JPXJD11B01R Shows high coverage and high confidence matches to the tellurium resistance protein TerD in multiple bacterial species. A brief literature search found that the gene has been found in phages infecting : Salmonella and Cronobacter spp.: https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-14-481 and https://atrium.lib.uoguelph.ca/xmlui/handle/10214/7414, Pseudomona spp https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4178739/, Clostridium spp. https://www.ncbi.nlm.nih.gov/pubmed/17322187, and Bacillus spp.: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4178739/ The domain, as shown in Phamerator is also found by the CDD: https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi?RID=JPXJCJHM01R Thanks, Steve |
Posted in: Request a new function on the SEA-PHAGES official list → TerD, tellurium resistance protein
Link to this post | posted 01 Jul, 2019 21:02 | |
---|---|
|
OK, here's a dumb question. But I figure, someone needs to ask them. I have seen the "Number of Genes" field in Phagesdb where it is a total including tRNA genes and where it doesn't include tRNAs gene and, presumably reflects only protein coding genes. I would assume it is supposed to be the CDS number since at the input it says '# of ORFs' not genes, but the output says 'genes.' Can you clarify, so I know for sure? Thanks, Steve |
Posted in: General Message Board → Phagesdb Entry Question