SEA-PHAGES Logo

The official website of the HHMI Science Education Alliance-Phage Hunters Advancing Genomics and Evolutionary Science program.

Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.

Cluster BE - terminase, small subunit

| posted 12 Aug, 2019 00:47
Hello all,

I think I might have the 'terminase, small subunit' in the BE2 IchabodCrane, which hasn't yet been identified. It looks very similar to gp3 from NEHalo in terms of coverage and the coiled-coils hits using PCOILS described in the forum post: https://seaphages.org/forums/topic/4736/.

IchabodCrane_gp121 MKECPICGKDKELDEFGRQITNPSKFYKWCRDCRLSMARRKKNNFDEGRALRSKTVQLRRLTDAQVTEVRLLAEWNTPYTEIAQQYGVSATTISKVVNRGYANVY

HHPred https://toolkit.tuebingen.mpg.de/#/jobs/Ichabod_g121
PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/ICH121

For reference, NEHalo gp3 in HHPred and PCOILS:

HHPred https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3b
PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3

Let me know what you think. Thanks!

Steve
Edited 12 Aug, 2019 00:49
| posted 12 Aug, 2019 18:19
Hi Steve,
I think 121 is located too far away from the other called terminase gene to be a viable candidate— unless we demonstrate it at the bench.

so not for now.
| posted 12 Aug, 2019 18:34
Welkin,

The thing that worries us about both this and Nehal 03 was that it looked a lot like we were seeing just the DNA binding part of a gene, like with the many anti-toxin hits we get that are really just HTH-domains. But it was similar enough to the previous call to merit a look.

Thanks!

Steve
 
Login to post a reply.