Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
cdshaffer posted in Whole phage starterator reports
fbaliraine posted in Phage DoRead Start at 52714 bp with 8 bp overlap vs start at 52718 with 4 bp overlap?
Debbie Jacobs-Sera posted in Phage DoRead Start at 52714 bp with 8 bp overlap vs start at 52718 with 4 bp overlap?
All posts created by fbaliraine
Link to this post | posted 14 Mar, 2019 17:52 | |
---|---|
|
The following sequence is for Glaske Gp 29 (120 bp): MNLTDALRTAAEVYNPDDTIDLLGLFIIGLPGSLPAIAALWVTIRGQRRGRARAQRVDAKTDEIHEHVVNTHTSNMRKDLDDLRELVVDGFRRVERDIGGIREEIRTERKERIAGDRRE I note that the majority of BLASTps show NKF for Glaske Gp 29. Although top hits show NKF, Glaske Gp 29 hits the minor tail protein of phage Xavier with q1:s1 in phages Db and NCBI. On the other hand though, HHPRED shows no minor tail protein, but hit # 5 (PF06120.11) shows 90% probability with the “tail length tape measure protein’ of phage HK97 (https://toolkit.tuebingen.mpg.de/#/jobs/Glaske_gp29 ). Nevertheless, no Chrystal structure nor related publication is shown on this hit, and even the BLAST hits were direct submissions with no related paper. Note also that Glaske has a clear, tape measure protein at Gp 17 (1217 bp); which is 10x plus longer than the Gp 29 (10bp). What’s the verdict? I am also attaching a pdf copy of HHPred in case the above hotlink expires. |
Link to this post | posted 23 Jan, 2018 16:47 | |
---|---|
|
Question 1: In Spring 2017, the BLAST notes included both sources, i.e. NCBI GeneBank and PhagesDb. This year's summary notes do not include these two. Do we need to include the phagesDb BLAST or just go by the NCBI Blast? See below what I am reading from the example in resource guide (https://seaphagesbioinformatics.helpdocsonline.com/officialdocumentation): "Blast-Start: [phage name, gene number, database, Q : S, coverage, e value/no significant BLAST alignments]. The best BLAST match for this gene that reflects the alignment at the start of the protein, and the alignment of the gene start with that BLAST match. (For example, “Matches KBG gp32, Query 1 to Subject 1”, 100%, 0.0” or “Aligns with Thibault gp45 q3:s45 65% 10-16). If the best BLAST alignment has an e value above 10-4, report “no significant BLAST alignments” Which BLAST Database is being assumed in this example: PhagesDB or GenBank? Question 2: With respect to e-values, supposing you get an e-value of 1.7 x 10-17, should we just record -17 as in the above example or do we include the leading values (1.7 in this example)? In a the same vein, DNA master does not allow for writing exponents; what are we expected to do in this case? Question 3: In the above example, the the "Query to subject" is given two ways, in one case the words written out in full, while being abbreviated in the other example. Previously we were required to abbreviate as Q:S. For purposes of consistence, which way does the QC Team want us to record this? Thanks! |
Link to this post | posted 21 Mar, 2017 16:08 | |
---|---|
|
We are finalizing our annotations but want to be sure of one thing before submission to the QC team. According to Fig 12.2 (attached) in the Resource Guide, the space under “product” is just having the feature number i.e. gp5. I mean, if say we had a “Hypothetical protein” or a known product like “lysin A”, do we still not put this information under product (and thus not replace the “gp5” in this example? Is it the QC team to fill in the product name? |
Posted in: Notes and Final Files → Filling in the Product field
Link to this post | posted 21 Apr, 2016 15:55 | |
---|---|
|
We have identified and annotated some programmed frameshifts. When we blast our fusion protein in phagesDb, we note that some hits indicate the frameshift, whereas others do not. In phage Gideon an example of a hit for gp 15, where the frameshift information is indicated is its 1:1, 100% alignment with "Angel_15, tail assembly chaperone; -1 frameshift." Should we note this in the DNA master file? If so, where exactly: Should it be under "Logic" or beside the function i.e. "F: tail assembly chaperone; -1 frameshift", or in under "Product"? Thanks! |
Posted in: Frameshifts and Introns → Annotation Advise: Frameshift
Link to this post | posted 25 Feb, 2016 23:47 | |
---|---|
|
Just to be sure: In The DNA Master description regarding SD scores, i.e. “SD: Final=-#.###, Z=#.###, Best SD” or “No, Final=-#.###, Z=#.###, ##nd Best (explain)’’ since we are providing both the Z value and the final score, which of the two values should we ultimately consider when stating whether it is the best SD score or not? For example, when comparing a final score = -4.711 and Z = 2.412 for one start with final score = -4.122 and z= 2.379 for the alternative start, if we rank on the basis of the final score, then -4.711 is second best, but when we rank on the basis of the Z value, then Z = 2.412 is the best, but you will notice that these two values give conflicting answers yet they belong to the same start position. Should we thus report the SD score ranking on the basis of the final score or the Z value? Thanks! |
Posted in: Notes and Final Files → SD Scoring in notes
Link to this post | posted 23 Feb, 2016 15:48 | |
---|---|
|
Just to be sure: Does BLAST in the DNA Master description (BLAST: Matches Phage gp##, q#:s# Aligns with PhageName gp## q##:s##) strictly refer to BLASTp in NCBI/DNA Master or could it be also in PhageDb? The reason I am asking is because in some cases DNA Master may show a q1:s1 match for a phage but in some cases when I change the start position from the one originally called by Glimmer/GeneMark, I get a q1:s1 in PhagesDb but not in NCBI. For example for position in Gideon_draft 28917 bp start position (Original Glimmer call @bp 2872 ![]() |
Posted in: Notes and Final Files → BLAST notes: PhagesDB or GenBank?
Link to this post | posted 11 Feb, 2016 16:46 | |
---|---|
|
What does "Conserved Domain ID - NCBI" and "Conserved Domain ID - Phamerator" mean in the annotation notes in DNA Master? Does it mean the accession number? See example in attached figure.I have looked at pages 109-110 in the DNA Master Guide 2016 but did not see the domain ID mentioned. Thanks! |
Posted in: Notes and Final Files → Conserved Domain ID in notes
Link to this post | posted 10 Feb, 2016 17:23 | |
---|---|
|
Both Andies and Willsterrel appear to have issues that have already been solved as both ran fine on my copy with my bug fixes, links to full reports below. Thanks cdshaffer! Will appreciate receiving the bug-fixed:Starterator version. |
Link to this post | posted 02 Feb, 2016 17:08 | |
---|---|
|
I have deleted all "Intermediate Files" folders in the cache as suggested by Dan Russell, "2. Some crashes have been fixed by deleting older files cached by starterator. These files can be found by going to your home directory, and select the menu item View -> "show hidden files" Once you select that, you will see many more files and folders in your home directory. Open the folder .starterator and inside there is a folder called "Intermediate Files". I have fixed many crashes by deleting all files in that folder and running starterator again." But "Andies_draft" still crashes at the same spot, stating "Startsaerator has encountered an error, please try again" as per attached snapshopt. Fred |