Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
All posts created by fbaliraine
| Link to this post | posted 06 Jun, 2025 20:50 | |
|---|---|
|
|
Thank you, Debbie! It is now available, Fred |
Posted in: Annotation → GeneMark Server Connection
| Link to this post | posted 04 Jun, 2025 22:57 | |
|---|---|
|
|
We have for about a week been unable to access GeneMark via phagesDB. We keep getting, "We could not connect to the GeneMark servers. If this error persists, please contact us." Any solution? Thanks! Fred |
Posted in: Annotation → GeneMark Server Connection
| Link to this post | posted 08 Apr, 2025 22:04 | |
|---|---|
|
|
Thank you, Debbie! I too was inclined to call it NKF given its size and the available HHPred data. Best regards, Fred |
| Link to this post | posted 08 Apr, 2025 01:42 | |
|---|---|
|
|
DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF? Fred |
| Link to this post | posted 27 Mar, 2025 18:53 | |
|---|---|
|
|
This helps clarify things! I have left the upstream gene intact (52714-52875 bp) and for the downstream gene (stop 54067 bp), I have changed the start to 52892 bp which is the most annotated start, also called in Che8 gp 108 and has a better RBS score than the auto-called start at 52907 bp. Thank you, Debbie! Fred |
Posted in: Choosing Start Sites → Phage DoRead Start at 52714 bp with 8 bp overlap vs start at 52718 with 4 bp overlap?
| Link to this post | posted 27 Mar, 2025 07:22 | |
|---|---|
|
|
Phage DoRead draft gene 103 (stop 52875 bp) in the +3 frame has significant coding potential (CP) only in GeneMarkS, and has an 8 bp overlap with the upstream gene which stops at 52721 bp. However, the gene in the +2 frame (stop 54067 bp) and is auto-called to start at 52907 bp has significant CP in both GeneMark_smeg & GeneMark_TB to allow it to start at 52718 bp, with a 4 bp ATGA overlap. Per Guiding Principle 12a, the ribosome is expected to prefer the operon. Keeping draft gene 103 (stop 52875 bp) means that the operon would have to go backwards to start at 52714 bp to make an 8 bp overlap rather than the ATGA overlap (start 52718 bp). So far, only phage Modragons gp104 takes this operon as the start. Several BLASTp results in phagesDB keep the 8 pb overlap start (52714 - 52875 bp) which is found in 69.5% of genes in pham. The start at 52718 which gives the 4 bp overlap is found in 54.2% of genes in pham. I also note that there is a string of operon genes with 1-4 bp overlaps starting from the two upstream genes all the way to the end of the genome (only the start at 52714 bp with an 8 bp overlap would break this pattern). What is your verdict? Change the start to 52718 bp and prefer the operon (meaning deleting the gene which stops at stop 52875 bp) or keep both genes? See attached |
Posted in: Choosing Start Sites → Phage DoRead Start at 52714 bp with 8 bp overlap vs start at 52718 with 4 bp overlap?
| Link to this post | posted 11 Mar, 2025 20:36 | |
|---|---|
|
|
Thank you Debbie for the clarification and congratulations to Krista and the entire Hatfull lab on the new paper in Cell! |
| Link to this post | posted 11 Mar, 2025 18:24 | |
|---|---|
|
|
Is draft feature 23 of DoRead at position 23627-24265 bp (639 bp long), a minor tail protein? Its aa sequence is: MAYDKQAWQNAPSTETPLSAGALNHMEDGIADAHTLAESKADSEHTHVLADVTDVVASAGEVNVLAGATVSTGELNTLDGVTSNVQTQLDGKAASSHNHSAANVTSGTLDIARIPVGNSGSTVCVGNDSRLSDQRVPVDGSVSSAKIASGSITNTHVSPSAAIAASKMSTGVQASLTKADGSVQKSGTAEGMWMGTTLPGTGTAGVLYVVVPZ Minor tail proteins are typically the 5 big genes (at least1000 bp long) downstream the tape measure…"There are usually not more than 5" (https://genomicsguide.seaphages.org/). We have already identified the other minor tail proteins. We have previously called this NKF, though there are some hits to minor tail proteins in some phages. But I notice a recent deposit in HHPred by Freeman K.G. et al, and this is the is the only significant hit in HHpred, hitting “Minor tail protein; Bacteriophage, tail tip” of Mycobacterium phage Bxb1 with 99.11% probability. Its PDB description at https://www.rcsb.org/structure/9D93 I wanted to cross-check before making the final call. Thanks! Fred |
| Link to this post | posted 27 Jan, 2025 17:09 | |
|---|---|
|
|
Hi Debbie, Thank you for your response. I just wish there was a way to zoom in or out of DNA Master or to adjust the text font size, but will settle for what we have. Best regards, Fred |
| Link to this post | posted 25 Jan, 2025 03:31 | |
|---|---|
|
|
The letter font size in DNA Master is quite small, and unlike a pdf or word document, we are unable to zoom in or zoom out. We project the DNA Master file on the white board, but because of the font size, both instructor and students are having trouble seeing the letters on the while screen/board unless we walk up close. I have asked my IT Team here and they tell me there needs to have a way to adjust the font size within the software or to zoom in. We have looked at the preferences but not seen any option to do that. Even if we adjust the font size on the PC, that does not help with DNA Master. Any suggestions? Thanks and Happy annotating! Fred |

213Kb