Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Viknesh Sivanathan posted in did you know you can do restriction digests in the microwave?
nic.vega posted in did you know you can do restriction digests in the microwave?
nic.vega posted in did you know you can do restriction digests in the microwave?
Viknesh Sivanathan posted in did you know you can do restriction digests in the microwave?
nic.vega posted in did you know you can do restriction digests in the microwave?
Portal/Head-t-o-tail Case Study Question
| Link to this post | posted 22 Nov, 2018 18:01 | |
|---|---|
|
I'm following up on Zetzy, an A3, that we used in the Hack-a-thon, and I have a quick question. I was able to call two genes NKF (that had been labeled otherwise in other phages), and another as head-to-tail adapter based on the Case Study and the table provided at end, that outlines the PDB hit requirements (5A21_D). But the next gene's PDB his is to 5A21_E, which is not listed. The only 'E' version of the entry contains SPP1 proteins 15, 16, and 17. Any thoughts? 'G/17' is downstream, so could this be 'F/16"? HHPred: https://toolkit.tuebingen.mpg.de/#/jobs/Zet_13195 Protein: MSLLDGGPQYEDILVFPEEAVTDEDGNTKTRPSATGIPAKARFQVQGQSGTSARRAEQDNEGFESEKVYRMRFPRSWDAEHGVLGAQSEIEWRGKRWALFGDVNFYNSSRRTARIDYTVKRYZ |
| Link to this post | posted 23 Nov, 2018 18:30 | |
|---|---|
|
Steve, 5A21_E is listed along with 5A21_F as a head-to-tail stopper. debbie |
| Link to this post | posted 23 Nov, 2018 18:36 | |
|---|---|
|
|
Thank you. I see it in the text, now, though the table at the end shows "F." Thanks, again. Steve |
| Link to this post | posted 23 Nov, 2018 18:54 | |
|---|---|
|
|
Steve, you mean the table at the end of the case study, right? That is because that gene only hits F and not E. I am not sure how to avoid the confusion. E is in the Functional Assignment list appropriately. If you have a better suggestion let me know. |