Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Dan Russell posted in Congrats to Steve Caruso and Beth Wilkes — 2025 ASM Outstanding Instructor Award, Honorable Mention
ACMPhageHunters posted in Clarification Question About HNH Endonuclease Function Determination in view of hits to the Ref Sequences
cdshaffer posted in Clarification Question About HNH Endonuclease Function Determination in view of hits to the Ref Sequences
Cluster BE - terminase, small subunit
| Link to this post | posted 12 Aug, 2019 00:47 | |
|---|---|
|
|
Hello all, I think I might have the 'terminase, small subunit' in the BE2 IchabodCrane, which hasn't yet been identified. It looks very similar to gp3 from NEHalo in terms of coverage and the coiled-coils hits using PCOILS described in the forum post: https://seaphages.org/forums/topic/4736/. IchabodCrane_gp121 MKECPICGKDKELDEFGRQITNPSKFYKWCRDCRLSMARRKKNNFDEGRALRSKTVQLRRLTDAQVTEVRLLAEWNTPYTEIAQQYGVSATTISKVVNRGYANVY HHPred https://toolkit.tuebingen.mpg.de/#/jobs/Ichabod_g121 PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/ICH121 For reference, NEHalo gp3 in HHPred and PCOILS: HHPred https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3b PCOILS https://toolkit.tuebingen.mpg.de/#/jobs/NEHALO3 Let me know what you think. Thanks! Steve |
| Link to this post | posted 12 Aug, 2019 18:19 | |
|---|---|
|
|
Hi Steve, I think 121 is located too far away from the other called terminase gene to be a viable candidate— unless we demonstrate it at the bench. so not for now. |
| Link to this post | posted 12 Aug, 2019 18:34 | |
|---|---|
|
|
Welkin, The thing that worries us about both this and Nehal 03 was that it looked a lot like we were seeing just the DNA binding part of a gene, like with the many anti-toxin hits we get that are really just HTH-domains. But it was similar enough to the previous call to merit a look. Thanks! Steve |
| Link to this post | posted 11 Aug, 2022 18:53 | |
|---|---|
|
|
Hello! I have a follow-up question about another potential small terminase gene, GalacticEye_Draft_6. I've attached a summary of the analysis I ran based on other forum posts on this topic. Key points below: Evidence FOR:
Evidence AGAINST:
|
| Link to this post | posted 12 Aug, 2022 15:33 | |
|---|---|
|
|
Hi Amanda, I see no clear evidence for calling this one anything but a Hypothetical Protein. (My best explanation for why some members of the pham are called terminase, small subunit is there was a moment in time when we thought we could call by synteny. But I would not recommend that today.) Best, debbie |
| Link to this post | posted 12 Aug, 2022 16:07 | |
|---|---|
|
|
Hi Debbie, Got it! I figured synteny was the reason the other pham members had been assigned that function. Thanks, Amanda |

84Kb