SEA-PHAGES Logo

The official website of the HHMI Science Education Alliance-Phage Hunters Advancing Genomics and Evolutionary Science program.

Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.

All posts created by rlb6

| posted 20 Dec, 2023 22:16
Has "ribosome modulation factor" been given any consideration as an official function? Belphegor gp13 (10420-10245)MIPRDQQPMPTPAEAIEAYKAGQVSRPGAGNPYAGRRVLGSVWALGNREAQRDAYTEFRRREAERRE
68AA, same pham as Fitzgerald.
Beckie Bortz
Posted in: Request a new function on the SEA-PHAGES official listRibosomal Modulation Factor
| posted 14 Jun, 2021 20:29
Regardless of whether I get the program from the FTP server or from the dropbox link, the installation of DNA Master is creating errors. Once I install and update, I get an "error creating fields", the program tries to "update helpers", and ends with "FTP failures". I enlisted help from Kristen and the same errors were obtained with a new installation on her machine. She tried turning off firewalls but this did not resolve the issue. DNA Master seems to essentially be working in this state but can't access data outside the program such as Blast or to pull in genomes for comparison. I am unaware what else may be affected. The Bitvise SSH client may be a solution to pull in all of the files correctly, but I am not savvy enough to know how to make it work. Any help is appreciated!

I hope this info helps to trouble-shoot this error and generate a reliable fix before a large number of students require it.
Beckie Bortz
Posted in: DNA MasterDNA master server down?
| posted 03 Jun, 2021 20:38
Thanks Chris, I did miss that step having more commonly worked on pc. I was able to install windows and then DNA Master. Unfortunately, I still don't have an error free copy of DNA Master as I'd hoped. smile
Beckie Bortz
Posted in: DNA MasterDNA master server down?
| posted 03 Jun, 2021 17:27
I successfully used the steps from howtogeek above on my pc but I'm still getting a lot of error messages from DNA Master (see post under DNAMaster>>key violation). So … I reinstalled the virtual machine on my Mac and I've gotten as far as saving dnamaster.exe to the VM desktop but it won't install and states "an error occurred while loading the archive". See attached screenshot. Any thoughts about how I can get some error free version of DNA Master up and running?
Beckie Bortz
Posted in: DNA MasterDNA master server down?
| posted 26 May, 2021 16:43
No change after restart. Still key violation error, "recent" files still missing, no msg that it can't find recentfile DB, no prompt for FTP.
Beckie Bortz
Posted in: DNA MasterKey Violation
| posted 26 May, 2021 16:28
I found the files but the problem is not resolved. (In Applications, right click on DNAMaster icon and select "show package contents". Click on "contents" then "resouurces" then "wineprefix" folder then "drive_c" then "program files" then "DNAMaster" then "DMDB".)

I moved all "recent" files to a new folder and deleted them from the DMDB folder and restarted DNA Master. DNA master can open an archived file, but it is still giving the same "key violation" error and I do not see that the "recent" files have been restored nor am I getting popup table with the prompt to download from FTP.

I'm going to try restarting my machine.
Beckie Bortz
Posted in: DNA MasterKey Violation
| posted 26 May, 2021 15:50
How does this advice apply to a mac running wine? I am getting the "key violation" error. Can I still produce GenBank and Phamerator files for submission with this error?
Beckie Bortz
Posted in: DNA MasterKey Violation
| posted 21 May, 2021 17:43
There is no appropriate official function for Gordonia phage Floral_39. There are, however, lots of hits for a SecB-like export protein or translocase. "The Escherichia coli soluble protein SecB is involved in the export of periplasmic and outer membrane proteins." Kumamoto CA. SecB protein: a cytosolic export factor that associates with nascent exported proteins. J Bioenerg Biomembr. 1990 Jun;22(3):337-51. doi: 10.1007/BF00763171. PMID: 2202722. Thoughts about this function?

MSKKMSLAEGREAMVRVLQEIQGLKAVRASRIECEALRPLPDSVEEAALVTDVKVSFHASPPYLATFVLYRVCATWGEADEFTDVAEEDQAWRITLEFCADWEVSADAELASEDLRCFAVSQGVMTCHPYARETIQSASVRMGYPPATLDIIRNPLIGDGEIEFED
Beckie Bortz
Posted in: Functional AnnotationSecB-like translocase or SecB export protein??
| posted 04 May, 2021 16:28
Hi I'm looking for the best function assignment for a Gordonia gene LonelyBoi_31. This gene has strong hhpred and blast hits to acyltransferase and SGNH domains. Many transmembrane helices are also predicted. I don't see any appropriate function on the Official function list
This is the amino acid sequence starting at nucleotide 29456 which seems to align best with the start of top hits:
LRLDIQGLRAVAVILVILDHLFEWPKAGFIGVDVFFVISGFVITAGLQRGYGRTGTISFGDFYRKRARRI
IPASTLVLVATCAAAAYAFYSSRFHETLIDAVWAFFFASNWRFAFQGTNYLTAEGPVSPLQHYWSLGIEE
QFYVVWPLLMLGVFTLAASRGLHAHSERIAAAAIGLVIAVSFSWAMIQTATHAEFAYFSTFTRVWELGIG
AMLALLAVEWKKIPDAARPFLAWVGLLGILVSAFIVSSESGFPAPWAALPVLATALVIAAGTGGERKHLY
PLTNPVASYIGDISYSLYLWHFPVIVILAAMMPSGWRYHFLCLALMSILSVLSYHILEDPVRKSTWLEPK
AVREDRRRLRRGASTTTLADSVGSAKWKIISLTAVLLVALAVVADGRGSDMSSVPDFTAAGQVSDNGAPT
SPLQAGLVEGVEATKWPANLSPSLEELGDISFPTADANGCAPATPRGRDCTIAGVDPSRLAVVVGDSISV
AWLPAIRAALEPKGWTVAALPYIGCPFVDGATENADATVVRTCPAHKQEVVDIINRAKPALVIGSSTNNI
RSARGESPENGARALSDQVAKIDAAAGRYVQLSPPPSGDNPQECATRFSSPRECLGGLPSNYTASVEAQK
AVMAGPGRQFVDTSDWFCTPEGDCPILNGSTLIRRDTSHITPQYAKVIAPQLASALLTTG
Beckie Bortz
Posted in: Functional Annotationacyltransferase and SGNH domains
| posted 15 Apr, 2020 14:55
FYI – The fix that Dan uses below recently (April 2020) worked for me as well. Thanks, Dan! –Beckie

DanRussell
Hi Katie,

I think this error is due to not having a certain library installed on the particular version of Windows that's running. That library wasn't required until after the update earlier this year to use secure NCBI servers. I think I came across that error myself, and in my notes I have that I went to the link below and installed the Visual C++ package there, then restarted and it worked.

https://www.microsoft.com/en-us/download/details.aspx?id=5555

Hopefully that helps,
–Dan
Beckie Bortz
Edited 15 Apr, 2020 14:56
Posted in: DNA MasterSSL error