Clifton (F1 Cluster phage) for gene 86 has decent HHpred data that was not called by other phages. It was not on the approved function list. The function is PGDYG protein found in bacteria. It is 150 amino acids in length. The alignment is 92.55%, the probability is 99.47, e-value is 1.2e-15. The data came from Pfam and the accession number is PF14083.5. The translation sequence for gp86 Clifton is:
MDPQKFRKKPLVIEAMRFTGSMNSAEQIAAWCGGRADFDPKPSDPTDANVSIAIPTLEGTMRASCGDYVIRGVQGEFYPCKPDIFEATYEAADZ

Pfam link: http://pfam.xfam.org/family/PF14083.5#tabview=tab0
HHpred job link: https://toolkit.tuebingen.mpg.de/#/jobs/9043598_3

The most recent DNA Masterfile for Clifton is attached. Could this possibly be a function that could be added to the list?
876Kb