Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
pia1@pitt.edu posted in GeneMarkS ?
Claire Rinehart posted in New Features in PECAAN
dane.bowder posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
Marie Fogarty posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
Debbie Jacobs-Sera posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
All posts created by chong17
Link to this post | posted 20 Apr, 2018 01:02 | |
---|---|
|
Clifton (F1 Cluster phage) for gene 86 has decent HHpred data that was not called by other phages. It was not on the approved function list. The function is PGDYG protein found in bacteria. It is 150 amino acids in length. The alignment is 92.55%, the probability is 99.47, e-value is 1.2e-15. The data came from Pfam and the accession number is PF14083.5. The translation sequence for gp86 Clifton is: MDPQKFRKKPLVIEAMRFTGSMNSAEQIAAWCGGRADFDPKPSDPTDANVSIAIPTLEGTMRASCGDYVIRGVQGEFYPCKPDIFEATYEAADZ Pfam link: http://pfam.xfam.org/family/PF14083.5#tabview=tab0 HHpred job link: https://toolkit.tuebingen.mpg.de/#/jobs/9043598_3 The most recent DNA Masterfile for Clifton is attached. Could this possibly be a function that could be added to the list? |