Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Dan Russell posted in Congrats to Steve Caruso and Beth Wilkes — 2025 ASM Outstanding Instructor Award, Honorable Mention
ACMPhageHunters posted in Clarification Question About HNH Endonuclease Function Determination in view of hits to the Ref Sequences
cdshaffer posted in Clarification Question About HNH Endonuclease Function Determination in view of hits to the Ref Sequences
Aca2-like protein
| Link to this post | posted 22 May, 2025 20:01 | |
|---|---|
|
|
Hi! We annotated Faiyaz (Y) this semester and would like to propose protein 48 and an "Aca-2 like protein". The sequence is: MTPAEFRIMREYLGLPPVWMAERLGVRERTVARWEHGHAPIPPGVVDEFTDILEVTARLVDSLIIQAGATGHLVTYRTDEDYRRSGSSYAATFPASWHRAVAARVYDAVPQVQITYSTDHSDDEAPGGCGSQV My students found: 1. Best HHpred hit is to https://www.rcsb.org/structure/7VJO, an apo-Aca2 from Pectobacterium phage ZF40. This is an Anticrispr 2 associated protein. 2. Used alpha fold to model dimer structure as is observed for 7VJO. 3. Used alphafold/fold seek to produce a decent overlay of the predicted Faiyaz protein structure with 7VJO. 4. Re-created a multiple sequence alignment from the PDB article to show conservation of secondary structures as well as four residues involved in DNA binding. I get a URL request for an image…A google doc with images is here: https://docs.google.com/document/d/1TlnnNQst0vGpW8CCGbNGr9ZTynJQhjQUMWy8SBZlPU8/edit?usp=sharing Thanks for considering, Allison & the VCU Phage Lab |
