Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Aca2-like protein
Link to this post | posted 22 May, 2025 20:01 | |
---|---|
|
Hi! We annotated Faiyaz (Y) this semester and would like to propose protein 48 and an "Aca-2 like protein". The sequence is: MTPAEFRIMREYLGLPPVWMAERLGVRERTVARWEHGHAPIPPGVVDEFTDILEVTARLVDSLIIQAGATGHLVTYRTDEDYRRSGSSYAATFPASWHRAVAARVYDAVPQVQITYSTDHSDDEAPGGCGSQV My students found: 1. Best HHpred hit is to https://www.rcsb.org/structure/7VJO, an apo-Aca2 from Pectobacterium phage ZF40. This is an Anticrispr 2 associated protein. 2. Used alpha fold to model dimer structure as is observed for 7VJO. 3. Used alphafold/fold seek to produce a decent overlay of the predicted Faiyaz protein structure with 7VJO. 4. Re-created a multiple sequence alignment from the PDB article to show conservation of secondary structures as well as four residues involved in DNA binding. I get a URL request for an image…A google doc with images is here: https://docs.google.com/document/d/1TlnnNQst0vGpW8CCGbNGr9ZTynJQhjQUMWy8SBZlPU8/edit?usp=sharing Thanks for considering, Allison & the VCU Phage Lab |