Hi!
We annotated Faiyaz (Y) this semester and would like to propose protein 48 and an "Aca-2 like protein".
The sequence is:
MTPAEFRIMREYLGLPPVWMAERLGVRERTVARWEHGHAPIPPGVVDEFTDILEVTARLVDSLIIQAGATGHLVTYRTDEDYRRSGSSYAATFPASWHRAVAARVYDAVPQVQITYSTDHSDDEAPGGCGSQV

My students found:
1. Best HHpred hit is to https://www.rcsb.org/structure/7VJO, an apo-Aca2 from Pectobacterium phage ZF40. This is an Anticrispr 2 associated protein.
2. Used alpha fold to model dimer structure as is observed for 7VJO.
3. Used alphafold/fold seek to produce a decent overlay of the predicted Faiyaz protein structure with 7VJO.
4. Re-created a multiple sequence alignment from the PDB article to show conservation of secondary structures as well as four residues involved in DNA binding.

I get a URL request for an image…A google doc with images is here:
https://docs.google.com/document/d/1TlnnNQst0vGpW8CCGbNGr9ZTynJQhjQUMWy8SBZlPU8/edit?usp=sharing

Thanks for considering,
Allison & the VCU Phage Lab
Edited yesterday, 20:01