Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.

Recent Activity

lysZ-like proteins?

Link to this post \| posted today, 13:04
nic.vega	After Tom Bernhardt's talk at the symposium, is there an annotation we can use for lysZ-like proteins? For example, we have Atlantica gp21 (CDS 16204-16494): Canonical structure (per Tom's talk) is a N-terminal TMD + a variable-length helical domain. gp21 has a N-terminal TMD (approx. residues 5-25, annotated as "TMD" rather than "signal" by DeepTMHMMM, confirmed with SOSUI); AlphaFold predicts extended alpha helical domain High-probability, near-full-length hits on HHPred to bacterial FtsB (e.g. 6H9N_B; cell division protein with one TMD; sticks N terminal domain in the membrane & associates other cell division complex stuff on the C terminal domain) and to phage spanins (e.g. P39504). Similar length (97 aa) to these proteins (94-121 aa). Located at the end of the tail assembly genes, immediately before endolysin Amino acid sequence: MSPELLTAILGAGGLAAIVPKLIDGWKAWRSGRAAEEKDKNKGLVDRLAAAEVRLEAEIMWRRANEEYAATLRRLLIEVYGVPADKLPPWPVRRTS

Link to this post | posted today, 13:04

nic.vega

After Tom Bernhardt's talk at the symposium, is there an annotation we can use for lysZ-like proteins? For example, we have Atlantica gp21 (CDS 16204-16494):

predicts

hits on HHPred

Located at the end of the tail assembly genes, immediately before endolysin
Amino acid sequence: MSPELLTAILGAGGLAAIVPKLIDGWKAWRSGRAAEEKDKNKGLVDRLAAAEVRLEAEIMWRRANEEYAATLRRLLIEVYGVPADKLPPWPVRRTS

Link to this post \| posted today, 13:04
nic.vega	whoops forgot the .dnam5 33Kb

Login to post a reply.