Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
cdshaffer posted in Fin anti-sigmaF factor
uOttawaPHAGE posted in Fin anti-sigmaF factor
Debbie Jacobs-Sera posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
nic.vega posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
Debbie Jacobs-Sera posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
DoRead gene stop 54884 bp: glycosyltransferase or NKF?
| Link to this post | posted 08 Apr, 2025 01:42 | |
|---|---|
|
DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF? Fred |
213Kb| Link to this post | posted 08 Apr, 2025 11:04 | |
|---|---|
|
Fred, I would call this Hypothetical Protein. The primary data sources have no hits. Also read the Glycosylation paper that describes the genes in Che8. https://pubmed.ncbi.nlm.nih.gov/37329881/ How many amino acids/domains are needs to be a glycosyltransferase? Best, debbie |
| Link to this post | posted 08 Apr, 2025 22:04 | |
|---|---|
|
|
Thank you, Debbie! I too was inclined to call it NKF given its size and the available HHPred data. Best regards, Fred |