Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.

Recent Activity

DoRead gene stop 54884 bp: glycosyltransferase or NKF?

Link to this post \| posted today, 01:42
fbaliraine	DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF? Fred 213Kb

Link to this post | posted today, 01:42

fbaliraine

DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ

Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF?
Fred