Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Debbie Jacobs-Sera posted in Help with Annotating Direct Terminal Repeats
Marie Fogarty posted in Help with Annotating Direct Terminal Repeats
cdshaffer posted in Help with Annotating Direct Terminal Repeats
Marie Fogarty posted in Help with Annotating Direct Terminal Repeats
Debbie Jacobs-Sera posted in Potential minor tail proteins in cluster GK
A small minor tail protein called based on solely on synteny?
| Link to this post | posted 06 May, 2022 17:34 | |
|---|---|
|
In the subcluster A11 phage Gilberta, we are seeing a small (189 bp long; position 25381-25569) gene hitting more than 60 minor tail protein genes in both NCBI and phagesDB. This gene is right downstream of a large (1992 bp long) minor tail protein gene which follows other minor tail proteins upstream of it. However, this small (189 bp) gene has neither hits to collagen-like, glycine-rich proteins, coiled-coils, nor any other significant hits in HHPred (Only one HHPred hit to Bacteriophage FRD2 protein, with 41.2% alignment and 11.9% probability). Could we still call it a minor tail protein solely based on synteny? Below is its amino acid sequence: MPWSPSPAFPQRQHRTAWFAELPAPTPAQHQTAWWAVYELDAPVEIACVTAAEGQEGPEEAVZ Thanks! Fred |
| Link to this post | posted 06 May, 2022 17:51 | |
|---|---|
|
Fred, I would not call this gene a minor tail protein. It is at the end of a string of minor tail proteins and the next genes change directions. In my mind, these genes could be anything. debbie |
| Link to this post | posted 06 May, 2022 18:27 | |
|---|---|
|
|
Thank you Debbie! Fred |