Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
cdshaffer posted in Whole phage starterator reports
fbaliraine posted in Phage DoRead Start at 52714 bp with 8 bp overlap vs start at 52718 with 4 bp overlap?
Debbie Jacobs-Sera posted in Phage DoRead Start at 52714 bp with 8 bp overlap vs start at 52718 with 4 bp overlap?
Cluster N HicA-like toxin/antitoxin functional assignment
Link to this post | posted 02 Jan, 2019 20:53 | |
---|---|
|
Hi all, I am currently working on QCing cluster N BabeRuth from our 2018 faculty hackathon. On the official functions list is says the Xeno_32 is the example for the toxin in toxin/antitoxin system, HicA-like, but this is not called in Phamerator. BabeRuth_40 is in the same pham as Xeno_32 (Pham 3607), we have currently annotated this as a membrane protein but could switch it to HicA-like if this is correct. In the prophage-mediated defense cluster N paper in figure 4 I think they are just labeled these as membrane proteins. Is this an error on the official functions list? I think BabeRuth_37 should be assigned the HicA-like toxin/antitoxin function based on HHPRED data and these are labeled as toxin in figure 4 of the paper, but see no such support for 40. BabeRuth_40 MENVPPSPPPGWYPDPVGSGGQRYWDGQRWTEHYAPPAVAAQIADRRFTVNYGFALLAFFSLLATVGLPLLAMAGGAGADVGPFAILWMLWGGMWTLVWTAFAIQHTLRNRR BabeRuth_37 MNRRIESLGGVQTRQRGSHRRYAVTYTDEMGIVRSAFTTVQQHKSQEIPLGTLRAIQRDLEPAFGKGWLLG |