Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Debbie Jacobs-Sera posted in Help with Annotating Direct Terminal Repeats
Marie Fogarty posted in Help with Annotating Direct Terminal Repeats
cdshaffer posted in Help with Annotating Direct Terminal Repeats
Marie Fogarty posted in Help with Annotating Direct Terminal Repeats
Debbie Jacobs-Sera posted in Potential minor tail proteins in cluster GK
Cluster N HicA-like toxin/antitoxin functional assignment
| Link to this post | posted 02 Jan, 2019 20:53 | |
|---|---|
|
Hi all, I am currently working on QCing cluster N BabeRuth from our 2018 faculty hackathon. On the official functions list is says the Xeno_32 is the example for the toxin in toxin/antitoxin system, HicA-like, but this is not called in Phamerator. BabeRuth_40 is in the same pham as Xeno_32 (Pham 3607), we have currently annotated this as a membrane protein but could switch it to HicA-like if this is correct. In the prophage-mediated defense cluster N paper in figure 4 I think they are just labeled these as membrane proteins. Is this an error on the official functions list? I think BabeRuth_37 should be assigned the HicA-like toxin/antitoxin function based on HHPRED data and these are labeled as toxin in figure 4 of the paper, but see no such support for 40. BabeRuth_40 MENVPPSPPPGWYPDPVGSGGQRYWDGQRWTEHYAPPAVAAQIADRRFTVNYGFALLAFFSLLATVGLPLLAMAGGAGADVGPFAILWMLWGGMWTLVWTAFAIQHTLRNRR BabeRuth_37 MNRRIESLGGVQTRQRGSHRRYAVTYTDEMGIVRSAFTTVQQHKSQEIPLGTLRAIQRDLEPAFGKGWLLG |