The official website of the HHMI Science Education Alliance-Phage Hunters Advancing Genomics and Evolutionary Science program.

• Forum Home /
• Science /
• Annotation /
• Request a new function on the SEA-PHAGES official list /
• Death on Curing (DOC) toxin/antitoxin in Gordonia terrae cluster DL

Death on Curing (DOC) toxin/antitoxin in Gordonia terrae cluster DL

Link to this post | posted 11 Jun, 2018 16:20

smichael

Goddonia terrae phage DatBoi (cluster DL - available in PECAAN) has a putative toxin/antitoxin pair (reverse genes 131/132 start: 78,758, stop: 78,365 / start: 78,948, stop: 78,751 NCBI and HHPRED show strong evidence that these are a Death on Curing (DOC) toxin/anti-toxin pair where the toxin is a translation elongation inhibitor and the anti-toxin is a transcription factor repressor that down-regulates expression of the stable toxin. These proteins are well described in E.coli phage (phage P1). There do not seem to be other described components of this system (but I am NOT a toxin expert). However, a third downstream NKF gene has a -4bp overlap and seems to be part of the operon. Toxin: MTDFLDREDVVTAGTVACGEQLIVRDEGLLQAAVARPRTSVFGIDAYPTHWDKAAALMHSLARNHPFVDGNKRTSWASANVFLHINGITPTDDLDVDRAEVFVNDVAKGVIDEWADIADGLRYLYGRGA Antitoxin: MPSLNVEFTDEEHAQIKAAAESAGVSLKPFVHDAAVDRSSEHRRRVLEASKSVAAWSSELNERLR Bacterial addiction module toxin Doc inhibits translation elongation through its association with the 30S ribosomal subunit https://doi.org/10.1073/pnas.0711949105

Link to this post | posted 11 Jun, 2018 21:45
welkin	So at this point, June 2018, we are going to stay with the generic toxin/antitoxin labels for these proteins.

Link to this post | posted 25 Feb, 2019 19:47
delesall	I'll note that there are also nice HHPred matches to a DOC toxin in Gordonia phage Melba, a CV phage - in a reverse gene just before the integrase

 

Login to post a reply.

© 2013-25, All rights reserved