Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.

Recent Activity

Acetyltransferase

Link to this post \| posted 19 Jul, 2018 19:45
delesall	For gp74 of Hank144, I have at least a dozen HHPred matches to an acetyltransferase. Top ten matches have probability greater than 93%, coverage 95% and E-value from 0.005 to 0.022. The best HHPred match is the Crystal structure of N-acetyltransferase from Staphylococcus aureus. That protein has 168aa - gp74 has 126. MTMRVYKVHHAIYIGALRQARRQSQLIADATSAPHEMPRSHTYYLTDDFQSGFGVAQDGTLVGLFSLIKGRGEDLVWDAILHHGATKLDCFDGFLPDYYKRFGFVETERVPNWTPGEPDVVFMSL Hank 144 is available on Pecaan if more info is needed on this request

Link to this post | posted 19 Jul, 2018 19:45

delesall

For gp74 of Hank144, I have at least a dozen HHPred matches to an acetyltransferase. Top ten matches have probability greater than 93%, coverage 95% and E-value from 0.005 to 0.022.

The best HHPred match is the Crystal structure of N-acetyltransferase from Staphylococcus aureus. That protein has 168aa - gp74 has 126.

MTMRVYKVHHAIYIGALRQARRQSQLIADATSAPHEMPRSHTYYLTDDFQSGFGVAQDGTLVGLFSLIKGRGEDLVWDAILHHGATKLDCFDGFLPDYYKRFGFVETERVPNWTPGEPDVVFMSL

Hank 144 is available on Pecaan if more info is needed on this request

Link to this post \| posted 20 Jul, 2018 15:31
welkin	approved!