Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
Dan Russell posted in Congrats to Steve Caruso and Beth Wilkes — 2025 ASM Outstanding Instructor Award, Honorable Mention
ACMPhageHunters posted in Clarification Question About HNH Endonuclease Function Determination in view of hits to the Ref Sequences
cdshaffer posted in Clarification Question About HNH Endonuclease Function Determination in view of hits to the Ref Sequences
Acetyltransferase
| Link to this post | posted 19 Jul, 2018 19:45 | |
|---|---|
|
|
For gp74 of Hank144, I have at least a dozen HHPred matches to an acetyltransferase. Top ten matches have probability greater than 93%, coverage 95% and E-value from 0.005 to 0.022. The best HHPred match is the Crystal structure of N-acetyltransferase from Staphylococcus aureus. That protein has 168aa - gp74 has 126. MTMRVYKVHHAIYIGALRQARRQSQLIADATSAPHEMPRSHTYYLTDDFQSGFGVAQDGTLVGLFSLIKGRGEDLVWDAILHHGATKLDCFDGFLPDYYKRFGFVETERVPNWTPGEPDVVFMSL Hank 144 is available on Pecaan if more info is needed on this request |
| Link to this post | posted 20 Jul, 2018 15:31 | |
|---|---|
|
|
approved! |
