Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
lysZ-like proteins?
Link to this post | posted yesterday, 13:04 | |
---|---|
|
After Tom Bernhardt's talk at the symposium, is there an annotation we can use for lysZ-like proteins? For example, we have Atlantica gp21 (CDS 16204-16494):
Amino acid sequence: MSPELLTAILGAGGLAAIVPKLIDGWKAWRSGRAAEEKDKNKGLVDRLAAAEVRLEAEIMWRRANEEYAATLRRLLIEVYGVPADKLPPWPVRRTS |
Link to this post | posted yesterday, 13:04 | |
---|---|
|
whoops forgot the .dnam5 |
Link to this post | posted today, 11:46 | |
---|---|
|
Hello Our lab at USF has been working on these cool TM genes now since 2022 (see: https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0276603) and also have wet lab data supporting a lysis function for these 1TMD proteins in phages that infect M. smeg. In Arthrobacter phages, we also noted that the 1TMD appears to be upstream of the putative endolysins and that there are also 1-2 other TMD genes in the vicinity. We have also found up to 4 TMD encoding genes in phages that infect smeg and Gordonia as well as similar 1TMD encoded proteins that are NOT in the lysis cassette area with lysins. My opinion at the moment is that calling a LysZ function needs to wait until 1) the data is actually published and 2) that the function observed in the Corynebacterium is also confirmed in smeg and our other hosts. The 1TMD is clearly involved in lysis, but there are also other functions for very similar proteins described in the literature (see: https://journals.asm.org/doi/10.1128/mbio.00813-22?url_ver=Z39.88-2003&rfr_id=ori:rid:crossref.org&rfr_dat=cr_pub%20%200pubmed).
RS Pollenz
|
Link to this post | posted today, 14:25 | |
---|---|
|
Thanks for the papers, this is very helpful! I agree it's *probably* lysis associated based on synteny - the cassette in these AS3 phage seems to be [4 TMD protein][1 TMD protein, spanin-like][endolysin][2 TMD protein, pretty canonical-looking phage holin] at the end of the structural genes & terminating at the back end of the reverse-strand block, not dissimilar to some of the Gordonia cassettes I think. If the function is conserved in other phage, I'd be surprised if it isn't similar here. |