SEA-PHAGES | DoRead gene stop 54884 bp: glycosyltransferase or NKF?

DoRead gene stop 54884 bp: glycosyltransferase or NKF?

Link to this post \| posted 08 Apr, 2025 01:42
fbaliraine	DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF? Fred 213Kb

Link to this post | posted 08 Apr, 2025 01:42

DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ

Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF?
Fred

Link to this post \| posted 08 Apr, 2025 11:04
debbie	Fred, I would call this Hypothetical Protein. The primary data sources have no hits. Also read the Glycosylation paper that describes the genes in Che8. https://pubmed.ncbi.nlm.nih.gov/37329881/ How many amino acids/domains are needs to be a glycosyltransferase? Best, debbie

Link to this post \| posted 08 Apr, 2025 22:04
fbaliraine	Thank you, Debbie! I too was inclined to call it NKF given its size and the available HHPred data. Best regards, Fred

Recent Activity

DoRead gene stop 54884 bp: glycosyltransferase or NKF?