Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
cdshaffer posted in Alphafold models of minor tail proteins
pchien posted in Alphafold models of minor tail proteins
pchien posted in Alphafold models of minor tail proteins
Debbie Jacobs-Sera posted in Adding genes in right arm of AS2 genomes
seaphages_usc posted in Adding genes in right arm of AS2 genomes
DoRead gene stop 54884 bp: glycosyltransferase or NKF?
| Link to this post | posted 08 Apr, 2025 01:42 | |
|---|---|
|
DoRead putative gene (54759- 54884 bp) has significant coding potential in both GeneMark_smeg & TB and is part of an operon with the upstream and downstream genes as is common in F1 phages. Its aa sequence is MTYTIGVVAHTKHADQLIHGPQVATVFKANERNTWSWWRHKZ Whereas PhagesDB & NCBI BlASTp yields multiple hits to glycosyltransferase including with phage Madiba gp 100, I note that it is Q4:S441 alignment albeit with 89% coverage, and HHPred shows no significant hits. Would you still call this a glycosyltransferase, or NKF? Fred |
213Kb| Link to this post | posted 08 Apr, 2025 11:04 | |
|---|---|
|
Fred, I would call this Hypothetical Protein. The primary data sources have no hits. Also read the Glycosylation paper that describes the genes in Che8. https://pubmed.ncbi.nlm.nih.gov/37329881/ How many amino acids/domains are needs to be a glycosyltransferase? Best, debbie |
| Link to this post | posted 08 Apr, 2025 22:04 | |
|---|---|
|
|
Thank you, Debbie! I too was inclined to call it NKF given its size and the available HHPred data. Best regards, Fred |