Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
All posts created by smichael
| Link to this post | posted 25 Jul, 2018 15:10 | |
|---|---|
|
What should we call proteins that have Blast (either phagesdb or NCBI) evidence for head-to-tail connector complex, but do not have HHPRED evidence? |
Posted in: Functional Annotation → Head-tail connectors
| Link to this post | posted 11 Jun, 2018 16:20 | |
|---|---|
|
|
Goddonia terrae phage DatBoi (cluster DL - available in PECAAN) has a putative toxin/antitoxin pair (reverse genes 131/132 start: 78,758, stop: 78,365 / start: 78,948, stop: 78,751 NCBI and HHPRED show strong evidence that these are a Death on Curing (DOC) toxin/anti-toxin pair where the toxin is a translation elongation inhibitor and the anti-toxin is a transcription factor repressor that down-regulates expression of the stable toxin. These proteins are well described in E.coli phage (phage P1). There do not seem to be other described components of this system (but I am NOT a toxin expert). However, a third downstream NKF gene has a -4bp overlap and seems to be part of the operon. Toxin: MTDFLDREDVVTAGTVACGEQLIVRDEGLLQAAVARPRTSVFGIDAYPTHWDKAAALMHSLARNHPFVDGNKRTSWASANVFLHINGITPTDDLDVDRAEVFVNDVAKGVIDEWADIADGLRYLYGRGA Antitoxin: MPSLNVEFTDEEHAQIKAAAESAGVSLKPFVHDAAVDRSSEHRRRVLEASKSVAAWSSELNERLR Bacterial addiction module toxin Doc inhibits translation elongation through its association with the 30S ribosomal subunit https://doi.org/10.1073/pnas.0711949105 |