Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
uOttawaPHAGE posted in Fin anti-sigmaF factor
Debbie Jacobs-Sera posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
nic.vega posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
Debbie Jacobs-Sera posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
nic.vega posted in Weird domain distribution over "cytosine methyltransferase" hits in an AS3 phage
All posts created by smichael
| Link to this post | posted 25 Jul, 2018 15:10 | |
|---|---|
|
What should we call proteins that have Blast (either phagesdb or NCBI) evidence for head-to-tail connector complex, but do not have HHPRED evidence? |
| Link to this post | posted 11 Jun, 2018 16:20 | |
|---|---|
|
|
Goddonia terrae phage DatBoi (cluster DL - available in PECAAN) has a putative toxin/antitoxin pair (reverse genes 131/132 start: 78,758, stop: 78,365 / start: 78,948, stop: 78,751 NCBI and HHPRED show strong evidence that these are a Death on Curing (DOC) toxin/anti-toxin pair where the toxin is a translation elongation inhibitor and the anti-toxin is a transcription factor repressor that down-regulates expression of the stable toxin. These proteins are well described in E.coli phage (phage P1). There do not seem to be other described components of this system (but I am NOT a toxin expert). However, a third downstream NKF gene has a -4bp overlap and seems to be part of the operon. Toxin: MTDFLDREDVVTAGTVACGEQLIVRDEGLLQAAVARPRTSVFGIDAYPTHWDKAAALMHSLARNHPFVDGNKRTSWASANVFLHINGITPTDDLDVDRAEVFVNDVAKGVIDEWADIADGLRYLYGRGA Antitoxin: MPSLNVEFTDEEHAQIKAAAESAGVSLKPFVHDAAVDRSSEHRRRVLEASKSVAAWSSELNERLR Bacterial addiction module toxin Doc inhibits translation elongation through its association with the 30S ribosomal subunit https://doi.org/10.1073/pnas.0711949105 |