Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
All posts created by brueschhoff
| Link to this post | posted 14 Nov, 2025 20:35 | |
|---|---|
|
Thank you both! I will streak out again. Best, Beth |
Posted in: Lysogeny/Immunity → Growing Liquid Cultures for lysogens
| Link to this post | posted 14 Nov, 2025 20:35 | |
|---|---|
|
|
Thank you both! I will streak out again. Best, Beth |
Posted in: Lysogeny/Immunity → Growing Liquid Cultures for lysogens
| Link to this post | posted 14 Nov, 2025 18:33 | |
|---|---|
|
|
Hi Debbie, Thank you for your reply. I streaked for single colonies and then did three patch plates. Would it be advisable to streak more? Best, Beth |
Posted in: Lysogeny/Immunity → Growing Liquid Cultures for lysogens
| Link to this post | posted 14 Nov, 2025 18:12 | |
|---|---|
|
|
Greetings, I am trying to grow liquid cultures of lysogens to be able to complete the sensitivity assay (11.5). However, when trying to grow up liquid cultures, there is very little bacterial growth, even though I have growth on a patch plate. I am concerned that I will not be able to get a lawn on the petri dishes. Does anyone have any advice? Thanks, Beth |
Posted in: Lysogeny/Immunity → Growing Liquid Cultures for lysogens
| Link to this post | posted 18 Sep, 2025 15:53 | |
|---|---|
|
|
Thanks Debbie, Very helpful. Yes, these would be phages not posted to phagesDB. I appreciate your input! Beth |
| Link to this post | posted 18 Sep, 2025 15:14 | |
|---|---|
|
|
Greetings, We were wondering, if we had a surplus number of phage that are not purified, is there a good time or way to preserve those to be processed in the future? Thank you, Beth Rueschhoff Indiana University Southeast |
| Link to this post | posted 28 Mar, 2024 15:58 | |
|---|---|
|
|
I have a question. In DoobyDoo, Feature 65 (on Phamerator), stop 45445, has some of the features of a RecA, but not all of them. Therefore, I do not believe we should call this a RecA recombinase. On this powerpoint, our cluster (DV), falls under the category of not having a RecA recombinase but calling it anyway. Does this mean that we should not call it a RecA recombinase, or that we should call it a RecA, even though it is not a true RecA recombinase? Thank you, Beth Rueschhoff Indiana University Southeast |
Posted in: SMART Function Investigations → RecA requirements
| Link to this post | posted 23 Feb, 2024 16:36 | |
|---|---|
|
|
Thank you so much to both of you for your help. Very interesting! |
| Link to this post | posted 22 Feb, 2024 15:59 | |
|---|---|
|
|
Sure, Sorry about that! We are annotating DoobyDoo and the phamerator feature number is 10. The stop codon is 8910. |
| Link to this post | posted 21 Feb, 2024 15:31 | |
|---|---|
|
|
Greetings, We are investigating the function of a protein with sequence: MEYMPADLARTLSAMARGTHNEICGFILDDWTLISVRNVAKLPTISFEMSMNAILGAVEMAAASGREILGTYHSHPGGSTEPSETDLHGWPRFIDGSYARYWVVTGDTVREFERTGEGSEIGFQLIHSIGIGVVVKRPEEGMDQSVPEDZ It belongs to a pham that indicates it is a metalloprotease. BLAST Hits indicate either a tail protein or a metalloprotease. If we look at HHPRED, many hits come as a metalloprotease, but without the HEXXH motif. Rather it has a JAMM/MPN Zinc Binding domain. Should we annotate this as a metalloprotease, even without the HEXXH motif? Thank you for your assistance! Beth Rueschhoff Indiana University Southeast |