Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
All posts created by Wabush
Link to this post | posted 25 Mar, 2021 21:18 | |
---|---|
|
Hi Chris, Thank-you so much for the explanation. It was very nice of you to write such a nice detailed response. Very helpful indeed. Much appreciated! Kieran |
Posted in: Functional Annotation → Phage gene annotation has matching phage genes have 4 different proteins - which one is a match?
Link to this post | posted 06 Mar, 2021 02:01 | |
---|---|
|
Wabush |
Posted in: Functional Annotation → Phage gene annotation has matching phage genes have 4 different proteins - which one is a match?
Link to this post | posted 06 Mar, 2021 02:01 | |
---|---|
|
I am annotating the phage Crewmate (gene 2![]() - The NCBI BlastP of the gene returns several matching phages and their proteins. - (See the attached image for details) The first 9 phages returned have high coverage (99.28%-100%), high alignment (>96%), low e-values (0), and high identity (>90%). (see the attached image for details)but they have annotated 4 different proteins and I am unsure which one is a good reference for the Crewmate gene 28? The proteins assigned to the 9 phages are: - Cas4 family exonuclease (4 of 9 phages called this) - Exonuclease (3 of 9 phages called this) - RepA-like helicase (1 of 9 phages called this) - Hypothetical protein (1 of 9 phages called this) Thank-you kindly for reading and for any help offered, Kieran References: A. Attached to this post is a screen shot of NCBI Blastp in PECAAN B. Protein Sequence: MTTPKVSTIKRGGARFYVDPDDGKIKVPGVTSIIGMLPKEFLRYWAAKEVAQTAVDSLPTVLQMILNDQSDAAVDFLKKSPDRNTRKAADTGTAAHDLFERMAKGETVGRVHPDLEPFVRHFDEFLTVAKPEYHFLEETVWSDKHAYAGSFDAYATIGGERLWLDNKTTRSGIHEEVGIQLAAYRFADSIIRADGGRVPMPTADGGAVLHVRPEGWKLVPVRCDEELFEVFLHLREVFKYEKEIKSTIVGREVFSGPAEDAPTGPKRRTPRARKAAE |