The official website of the HHMI Science Education Alliance-Phage Hunters Advancing Genomics and Evolutionary Science program.

• Forum Home /
• Science /
• Cluster-Specific Annotation Tips /
• Cluster D Annotation Tips /
• Holin in D1

Holin in D1

Link to this post | posted 30 Jul, 2019 00:26
jparker	Has the holin in D1 been identified? There is a 4 transmembrane domain protein only called a holin in one cluster D1 phage (Nova gp37), all the rest call membrane domain or NKF. This is a conserved gene located between the lysin A and lysin B. How much evidence is needed to designate this as the holin?

Link to this post | posted 30 Jul, 2019 17:51
debbie	Jordan - I have a quick question (without looking) Are there any other membrane proteins in the region? If not, then it is acceptable to call this a holin. If there are other proteins that could be the holins adjacent to these 2 genes, then i would leave it at membrane protein. If it is more confusing that this and you want me to take a longer look, let me know. debbie

Link to this post | posted 30 Jul, 2019 18:09

jparker

Thanks, Debbie! There is an other membrane protein near by. I'll paste the sequences here if you want to take a look, but I'll go with membrane protein for now. >Helpful_37 (membrane protein) MKNLSNYWKAGIALVGTAGTAVATLAADENVRTAVGESGVTWLAVAGVALTTALTWLKRNEPTVTEAEEILRRAKERASSSSSA - TMHMM and SOSUI predict 2 TM domains and phobius predicts a signal peptide and one TM. Mixed results from TOPCONS, but def. signal peptide. >Helpful_39 (membrane protein) MFRPTDSRRLRSIFRKPRRIDHGRMYVSCMMGLWVWSLSLLVIGPVPNSTIDELTDYVQNILASCIFIGSFVCLCGIAIGTKYVLPKADIRLCYRFSLWGIPALAGSVGTYAWAIAHNTGSFWVSAYAASIGAFICLGIVWNGLDLLFEIARLNEEINYLKYGAGSEERLEDRDDERKC - 4 TM domains confirmed with TOPCONS, phobius, SOSUI and TMHMM

Link to this post | posted 30 Jul, 2019 18:50
debbie	Jordan, A good question, thanks for making it easy to check. I would call both Membrane proteins. debbie

 

Login to post a reply.

© 2013-24, All rights reserved