Welcome to the forums at seaphages.org. Please feel free to ask any questions related to the SEA-PHAGES program. Any logged-in user may post new topics and reply to existing topics. If you'd like to see a new forum created, please contact us using our form or email us at info@seaphages.org.
Recent Activity
dane.bowder posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
Marie Fogarty posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
Debbie Jacobs-Sera posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
dane.bowder posted in capsid maturation protease or hypothetical protein (MuF-like minor capsid protein)
a wrap around gene at the end
Link to this post | posted 24 Jul, 2018 03:49 | |
---|---|
|
The last feature of this genome is not in phamerator or in the gene list on phagesDB: CDS join(16287..16604,1..96) /gene="25" /locus_tag="PBI_EMPEROR_25" /codon_start=1 /transl_table=11 /product="HNH endonuclease" /translation="MTALPAWAGDYSRRLTALCLATYGDTCHLCGRPGATTADHLIPR SVSYDDSLANLRPAHQRCNSARGAMPIETWRARFTASTAPRSSRWSRPSSSLTPQVSA ALRPAAFFSPNAQNKGSVHTEKPSETTKGPDNATT" |